SCOPe 2.05: Domain d1cnza_: 1cnz A:

Lineage for d1cnza_ (1cnz A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
   consists of two intertwined (sub)domains related by pseudo dyad; duplication
   3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest

4. Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families)
   the constituent families form similar dimers

5. Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
   the active site is between the two identical subunits

6. Protein 3-isopropylmalate dehydrogenase, IPMDH [53661] (11 species)

7. Species Salmonella typhimurium [TaxId:90371] [53666] (1 PDB entry)

8. Domain d1cnza_: 1cnz A: [35061]
   complexed with mn, so4

Details for d1cnza_

PDB Entry: 1cnz, 1.76 Å

PDB Description: 3-isopropylmalate dehydrogenase (ipmdh) from salmonella typhimurium

PDB Compounds: (A:) protein (3-isopropylmalate dehydrogenase)

SCOPe Domain Sequences for d1cnza_:

Sequence; same for both SEQRES and ATOM records:

>d1cnza_ c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPMDH {Salmonella typhimurium [TaxId: 90371]}
msknyhiavlpgdgigpevmaqalkvmdavrsrfdmrittshydvggiaidnhghplpka
tvegceqadailfgsvggpkwenlppesqpergallplrkhfklfsnlrpaklyqgleaf
cplradiaangfdilcvreltggiyfgqpkgregsgqyekafdtevyhrfeieriariaf
esarkrrrkvtsidkanvlqssilwreivndvaktypdvelahmyidnatmqlikdpsqf
dvllcsnlfgdilsdecamitgsmgmlpsaslneqgfglyepaggsapdiagknianpia
qilslalllrysldandaataieqainraleegvrtgdlargaaavstdemgdiiaryva
egv

Timeline for d1cnza_:

• d1cnza_ first appeared (with stable ids) in SCOP 1.55
  
• d1cnza_ appears in SCOPe 2.04
  
• d1cnza_ appears in SCOPe 2.06
  
• d1cnza_ appears in the current release, SCOPe 2.08