Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.77: Isocitrate/Isopropylmalate dehydrogenases [53658] (1 superfamily) consists of two intertwined (sub)domains related by pseudodyad; duplication 3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest |
Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenases [53659] (2 families) |
Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (3 proteins) the active site is between the two identical subunits |
Protein 3-isopropylmalate dehydrogenase, IPMDH [53661] (6 species) |
Species Salmonella typhimurium [TaxId:90371] [53666] (1 PDB entry) |
Domain d1cnza_: 1cnz A: [35061] |
PDB Entry: 1cnz (more details), 1.76 Å
SCOP Domain Sequences for d1cnza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cnza_ c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPMDH {Salmonella typhimurium} msknyhiavlpgdgigpevmaqalkvmdavrsrfdmrittshydvggiaidnhghplpka tvegceqadailfgsvggpkwenlppesqpergallplrkhfklfsnlrpaklyqgleaf cplradiaangfdilcvreltggiyfgqpkgregsgqyekafdtevyhrfeieriariaf esarkrrrkvtsidkanvlqssilwreivndvaktypdvelahmyidnatmqlikdpsqf dvllcsnlfgdilsdecamitgsmgmlpsaslneqgfglyepaggsapdiagknianpia qilslalllrysldandaataieqainraleegvrtgdlargaaavstdemgdiiaryva egv
Timeline for d1cnza_: