![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
![]() | Superfamily g.41.2: Microbial and mitochondrial ADK, insert 'zinc finger' domain [57774] (2 families) ![]() automatically mapped to Pfam PF05191 |
![]() | Family g.41.2.1: Microbial and mitochondrial ADK, insert 'zinc finger' domain [57775] (1 protein) |
![]() | Protein Microbial and mitochondrial ADK, insert 'zinc finger' domain [57776] (9 species) |
![]() | Species Escherichia coli [TaxId:562] [57778] (10 PDB entries) contains a rudiment form of the domain that lacks zn-binding site |
![]() | Domain d6f7ua2: 6f7u A:122-156 [350608] Other proteins in same PDB: d6f7ua1 automated match to d1akea2 complexed with gcp, mg |
PDB Entry: 6f7u (more details), 1.4 Å
SCOPe Domain Sequences for d6f7ua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6f7ua2 g.41.2.1 (A:122-156) Microbial and mitochondrial ADK, insert 'zinc finger' domain {Escherichia coli [TaxId: 562]} grrvhapsgrvyhvkfnppkvegkddvtgeelttr
Timeline for d6f7ua2: