Lineage for d6fkwa_ (6fkw A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
    consists of eight 4-stranded beta-sheet motifs; meander
    also found in some members of the WD40-repeat superfamily
  4. Superfamily b.70.1: Quinoprotein alcohol dehydrogenase-like [50998] (2 families) (S)
  5. Family b.70.1.0: automated matches [227985] (1 protein)
    not a true family
  6. Protein automated matches [227986] (6 species)
    not a true protein
  7. Species Methylacidiphilum fumariolicum [TaxId:1156937] [227987] (2 PDB entries)
  8. Domain d6fkwa_: 6fkw A: [350599]
    automated match to d4maea_
    complexed with eu, pqq

Details for d6fkwa_

PDB Entry: 6fkw (more details), 1.4 Å

PDB Description: europium-containing methanol dehydrogenase
PDB Compounds: (A:) methanol dehydrogenase

SCOPe Domain Sequences for d6fkwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fkwa_ b.70.1.0 (A:) automated matches {Methylacidiphilum fumariolicum [TaxId: 1156937]}
ndeliklekepgqwvmqnknyantryselnqintknvsrlrlawsfstgalrgheggplv
vgttmyvhsaypnhvyaldltqkpyaikwqytpvqnsqavavaccdvvnrglayangkif
mttldgqiialdantgkelwkmkhadvtkgetitgaplvvkdkvlvgvsggefgvrgrvg
aydintgnrvwlaysqgpdeevlldsdfnkefpqhggpgdgtktwpgeqwklgggttwgw
ysydpaldlfyygtsnpgtwnaeqrkggdnkwsctifarrpdtgkarwayqmtpwdswdy
dgvnemilpdltvkgkktpclvhfdrngfgyvldrrtgqlieaqpfvyvnwakeiskend
rpveipekrtkqgvdtkgicpnsmggkdqqpaafspqtglfyvptnnmcmnyegveatyt
agapyvganvlmysghegkddyygaficydalkgkrvweihehfpvwsgpvvtagglafy
gtmdgwfkavdiktgkvlwqqklgsgiignpitflgpdkkqyvavysgvggwfgiavaqn
lppddpyaglgavgvayqaglpkattvggelyvfal

SCOPe Domain Coordinates for d6fkwa_ are not available.

Timeline for d6fkwa_:

Domains from other chains:
(mouse over for more information)
d6fkwb_, d6fkwc_, d6fkwd_