SCOPe 2.08: Domain d6fkda_: 6fkd A:

Lineage for d6fkda_ (6fkd A:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily)
   core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane

4. Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families)
   Pfam PF13853. Phylogeny described in PubMed 12761335

5. Family f.13.1.2: Rhodopsin-like [81320] (2 proteins)
   Individual TM segments have a number of kinks and distortions

6. Protein automated matches [190300] (1 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [188510] (18 PDB entries)

8. Domain d6fkda_: 6fkd A: [350595]
   automated match to d1l9ha_
   complexed with bog, dl2, plm

Details for d6fkda_

PDB Entry: 6fkd, 2.49 Å

PDB Description: crystal structure of n2c/d282c stabilized opsin bound to rs16

PDB Compounds: (A:) rhodopsin

SCOPe Domain Sequences for d6fkda_:

Sequence; same for both SEQRES and ATOM records:

>d6fkda_ f.13.1.2 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
mcgtegpnfyvpfsnktgvvrspfeapqyylaepwqfsmlaaymfllimlgfpinfltly
vtvqhkklrtplnyillnlavadlfmvfggftttlytslhgyfvfgptgcnlegffatlg
geialwslvvlaieryvvvckpmsnfrfgenhaimgvaftwvmalacaapplvgwsryip
egmqcscgidyytpheetnnesfviymfvvhfiipliviffcygqlvftvkeaaaqqqes
attqkaekevtrmviimviaflicwlpyagvafyifthqgscfgpifmtipaffaktsav
ynpviyimmnkqfrncmvttlccgkn

Timeline for d6fkda_:

• d6fkda_ first appeared in SCOPe 2.07