SCOP 1.69: Domain d2ayqb_: 2ayq B:

Lineage for d2ayqb_ (2ayq B:)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
   consists of two intertwined (sub)domains related by pseudo dyad; duplication
   3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest

4. Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (5 families)
   the constituent families form similar dimers

5. Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (3 proteins)
   the active site is between the two identical subunits

6. Protein 3-isopropylmalate dehydrogenase, IPMDH [53661] (7 species)

7. Species Bacillus coagulans [TaxId:1398] [53664] (1 PDB entry)

8. Domain d2ayqb_: 2ayq B: [35058]

Details for d2ayqb_

PDB Entry: 2ayq, 3 Å

PDB Description: 3-isopropylmalate dehydrogenase from the moderate facultative thermophile, bacillus coagulans

SCOP Domain Sequences for d2ayqb_:

Sequence; same for both SEQRES and ATOM records:

>d2ayqb_ c.77.1.1 (B:) 3-isopropylmalate dehydrogenase, IPMDH {Bacillus coagulans}
mkmklavlpgdgigpevmdaairvlktvldndgheavfenaliggaaideagtplpeetl
dicrrsdaillgavggpkwdhnpaslrpekgllglrkemglfanlrpvkayatllnaspl
krervenvdlvivreltgglyfgrpserrgpgenevvdtlaytreeieriiekafqlaqi
rrkklasvdkanvlessrmwreiaeetakkypdvelshmlvdstsmqlianpgqfdvivt
enmfgdilsdeasvitgslgmlpsaslrsdrfgmyepvhgsapdiagqgkanplgtvlsa
almlrysfglekeaaaiekavddvlqdgyctgdlqvangkvvstieltdrlieklnn

Timeline for d2ayqb_:

• d2ayqb_ first appeared (with stable ids) in SCOP 1.55
  
• d2ayqb_ appears in SCOP 1.67
  
• d2ayqb_ appears in SCOP 1.71
  
• d2ayqb_ appears in the current release, SCOPe 2.08