Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.218: Nucleotidyltransferase [81302] (1 superfamily) core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123 |
Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) |
Family d.218.1.0: automated matches [227287] (1 protein) not a true family |
Protein automated matches [227105] (6 species) not a true protein |
Species Staphylococcus aureus [TaxId:1280] [350555] (4 PDB entries) |
Domain d6fgxb_: 6fgx B: [350556] automated match to d5f2vq_ complexed with apc, mg |
PDB Entry: 6fgx (more details), 2.9 Å
SCOPe Domain Sequences for d6fgxb_:
Sequence, based on SEQRES records: (download)
>d6fgxb_ d.218.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 1280]} dtllgfveldhiyssalkeistklsilddnfnhiykhnpihhmerrvkemrslieklnrk glqisaetakehildiagirvvcnylddiylieemllkqedvqlikrkdyiqhpkengyr slhivvsipvflaervevlpveiqirtigmdmwaslehkiryknnaetekyrdllkecat eitevedklqqihseit
>d6fgxb_ d.218.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 1280]} dtllgfveldhiyssalkeistklsilddnfnhiykhnpihhmerrvkemrslieklnrk glqisaetakehildiagirvvcnylddiylieemllkqedvqlikrkdyiqhpkengyr slhivvsipvflaervevlpveiqirtigmdmwaslehkiraetekyrdllkecateite vedklqqihseit
Timeline for d6fgxb_: