Lineage for d6fgxb_ (6fgx B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2612756Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 2612757Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) (S)
  5. 2613254Family d.218.1.0: automated matches [227287] (1 protein)
    not a true family
  6. 2613255Protein automated matches [227105] (6 species)
    not a true protein
  7. 2613284Species Staphylococcus aureus [TaxId:1280] [350555] (4 PDB entries)
  8. 2613291Domain d6fgxb_: 6fgx B: [350556]
    automated match to d5f2vq_
    complexed with apc, mg

Details for d6fgxb_

PDB Entry: 6fgx (more details), 2.9 Å

PDB Description: crystal structure of the small alarmone synthethase 2 from staphylococcus aureus bound to ampcpp
PDB Compounds: (B:) GTP pyrophosphokinase

SCOPe Domain Sequences for d6fgxb_:

Sequence, based on SEQRES records: (download)

>d6fgxb_ d.218.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 1280]}
dtllgfveldhiyssalkeistklsilddnfnhiykhnpihhmerrvkemrslieklnrk
glqisaetakehildiagirvvcnylddiylieemllkqedvqlikrkdyiqhpkengyr
slhivvsipvflaervevlpveiqirtigmdmwaslehkiryknnaetekyrdllkecat
eitevedklqqihseit

Sequence, based on observed residues (ATOM records): (download)

>d6fgxb_ d.218.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 1280]}
dtllgfveldhiyssalkeistklsilddnfnhiykhnpihhmerrvkemrslieklnrk
glqisaetakehildiagirvvcnylddiylieemllkqedvqlikrkdyiqhpkengyr
slhivvsipvflaervevlpveiqirtigmdmwaslehkiraetekyrdllkecateite
vedklqqihseit

SCOPe Domain Coordinates for d6fgxb_:

Click to download the PDB-style file with coordinates for d6fgxb_.
(The format of our PDB-style files is described here.)

Timeline for d6fgxb_: