![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
![]() | Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) ![]() |
![]() | Family b.38.1.5: LSM14 N-terminal domain-like [141297] (2 proteins) automatically mapped to Pfam PF14438 automatically mapped to Pfam PF12701 |
![]() | Protein automated matches [254634] (3 species) not a true protein |
![]() | Species Homo sapiens [TaxId:9606] [350553] (1 PDB entry) |
![]() | Domain d6f9wa_: 6f9w A: [350554] automated match to d2fb7a1 protein/RNA complex |
PDB Entry: 6f9w (more details), 2.62 Å
SCOPe Domain Sequences for d6f9wa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6f9wa_ b.38.1.5 (A:) automated matches {Homo sapiens [TaxId: 9606]} tpyigskisliskaeiryegilytidtenstvalakvrsfgtedrptdrpipprdevfey iifrgsdikdltvc
Timeline for d6f9wa_: