Lineage for d6f9wa_ (6f9w A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2396390Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2396391Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2396996Family b.38.1.5: LSM14 N-terminal domain-like [141297] (2 proteins)
    automatically mapped to Pfam PF14438
    automatically mapped to Pfam PF12701
  6. 2397000Protein automated matches [254634] (3 species)
    not a true protein
  7. 2397003Species Homo sapiens [TaxId:9606] [350553] (1 PDB entry)
  8. 2397004Domain d6f9wa_: 6f9w A: [350554]
    automated match to d2fb7a1
    protein/RNA complex

Details for d6f9wa_

PDB Entry: 6f9w (more details), 2.62 Å

PDB Description: crystal structure of the lsm domain of lsm14 in complex with a c- terminal peptide of 4e-t
PDB Compounds: (A:) Protein LSM14 homolog A

SCOPe Domain Sequences for d6f9wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6f9wa_ b.38.1.5 (A:) automated matches {Homo sapiens [TaxId: 9606]}
tpyigskisliskaeiryegilytidtenstvalakvrsfgtedrptdrpipprdevfey
iifrgsdikdltvc

SCOPe Domain Coordinates for d6f9wa_:

Click to download the PDB-style file with coordinates for d6f9wa_.
(The format of our PDB-style files is described here.)

Timeline for d6f9wa_: