Lineage for d1xad__ (1xad -)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 27255Fold c.77: Isocitrate & isopropylmalate dehydrogenases [53658] (1 superfamily)
  4. 27256Superfamily c.77.1: Isocitrate & isopropylmalate dehydrogenases [53659] (1 family) (S)
  5. 27257Family c.77.1.1: Isocitrate & isopropylmalate dehydrogenases [53660] (2 proteins)
  6. 27258Protein 3-isopropylmalate dehydrogenase, IPMDH [53661] (6 species)
  7. 27262Species Chimera (Thermus thermophilus) and (Bacillus subtilis) [TaxId:274] [53663] (2 PDB entries)
  8. 27263Domain d1xad__: 1xad - [35055]

Details for d1xad__

PDB Entry: 1xad (more details), 2.1 Å

PDB Description: chimera isopropylmalate dehydrogenase between bacillus subtilis (m) and thermus thermophilus (t) from n-terminal: 20% t middle 20% m residual 60% t, mutated at s82r. low temperature (150k) structure.

SCOP Domain Sequences for d1xad__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xad__ c.77.1.1 (-) 3-isopropylmalate dehydrogenase, IPMDH {Chimera (Thermus thermophilus) and (Bacillus subtilis)}
mkvavlpgdgigpevteaalkvlraldeaeglglayevfpfggaaidafgepfpeptrkg
veeaeavllgsvggpkwdqnprelrpekgllsirkqldlfanlrpvkvfeslsdasplkk
eyidnvdfvivreltggiyfgeprgmseaeawnteryskpevervarvafeaarkrrkhv
vsvdkanvlevgefwrktveevgrgypdvalehqyvdamamhlvrsparfdvvvtgnifg
dilsdlasvlpgslgllpsaslgrgtpvfepvhgsapdiagkgianptaailsaammleh
afglvelarkvedavakalletpppdlggsagteaftatvlrhla

SCOP Domain Coordinates for d1xad__:

Click to download the PDB-style file with coordinates for d1xad__.
(The format of our PDB-style files is described here.)

Timeline for d1xad__: