Lineage for d6caua1 (6cau A:19-110)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.5: MurCD N-terminal domain [51983] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; incomplete Rossmann-like fold; binds UDP group
  4. Superfamily c.5.1: MurCD N-terminal domain [51984] (2 families) (S)
  5. Family c.5.1.0: automated matches [254240] (1 protein)
    not a true family
  6. Protein automated matches [254548] (7 species)
    not a true protein
  7. Species Acinetobacter baumannii [TaxId:470] [350525] (1 PDB entry)
  8. Domain d6caua1: 6cau A:19-110 [350526]
    Other proteins in same PDB: d6caua2, d6caua3
    automated match to d1gqqa1
    complexed with anp, mg

Details for d6caua1

PDB Entry: 6cau (more details), 2.5 Å

PDB Description: udp-n-acetylmuramate--alanine ligase from acinetobacter baumannii ab5075-uw with amppnp
PDB Compounds: (A:) UDP-N-acetylmuramate--L-alanine ligase

SCOPe Domain Sequences for d6caua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6caua1 c.5.1.0 (A:19-110) automated matches {Acinetobacter baumannii [TaxId: 470]}
mrrikhihfvgiggagmcgiaevlanqgykisgsdikaskttqqleengikvyigheaen
iknanvlvvstaidpenpevkaaieqripivr

SCOPe Domain Coordinates for d6caua1 are not available.

Timeline for d6caua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6caua2, d6caua3