Lineage for d6cswc_ (6csw C:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. Protein automated matches [190417] (36 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187294] (1454 PDB entries)
  8. Domain d6cswc_: 6csw C: [350521]
    automated match to d6bu6a_
    complexed with act, cl, fby, gol, pg4, so4

Details for d6cswc_

PDB Entry: 6csw (more details), 2.25 Å

PDB Description: crystal structure of the human vaccinia-related kinase bound to a n- methyl-n-propyl-dihydropteridine inhibitor
PDB Compounds: (C:) Serine/threonine-protein kinase VRK1

SCOPe Domain Sequences for d6cswc_:

Sequence, based on SEQRES records: (download)

>d6cswc_ d.144.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aeqfavgeiitdmaaaawkvglpigqggfgciyladmnssesvgsdapcvvkvepsdngp
lftelkfyqraakpeqiqkwirtrklkylgvpkywgsglhdkngksyrfmimdrfgsdlq
kiyeanakrfsrktvlqlslrildileyiheheyvhgdikasnlllnyknpdqvylvdyg
layrycpegvhkayaadpkrchdgtieftsidahngvapsrrgdleilgycmiqwltghl
pwednlkdpkyvrdskiryreniaslmdkcfpaanapgeiakymetvklldytekplyen
lrdillqglkaigskddgkldl

Sequence, based on observed residues (ATOM records): (download)

>d6cswc_ d.144.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aeqfavgeiitdmaaaawkvglpigqfgciyladmnssesvgsdapcvvkvepsdngplf
telkfyqraakpeqiqkwirtrklkylgvpkywgsglhdkngksyrfmimdrfgsdlqki
yeanakrfsrktvlqlslrildileyiheheyvhgdikasnlllnyknpdqvylvdygla
yrycpegvhkayaadprchdgtieftsidahngvapsrrgdleilgycmiqwltghlpwe
dnlkdpkyvrdskiryreniaslmdkcfpaanapgeiakymetvklldytekplyenlrd
illqglkaigskddgkldl

SCOPe Domain Coordinates for d6cswc_ are not available.

Timeline for d6cswc_:

Domains from other chains:
(mouse over for more information)
d6cswa_, d6cswb_, d6cswd_