| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.130: Chorismate mutase II [48599] (1 superfamily) multihelical; core: 6 helices, bundle |
Superfamily a.130.1: Chorismate mutase II [48600] (5 families) ![]() |
| Family a.130.1.0: automated matches [237401] (1 protein) not a true family |
| Protein automated matches [237402] (7 species) not a true protein |
| Species Burkholderia thailandensis [TaxId:271848] [237403] (2 PDB entries) |
| Domain d6cnzc_: 6cnz C: [350492] automated match to d4oj7c_ complexed with edo, no3 |
PDB Entry: 6cnz (more details), 2.15 Å
SCOPe Domain Sequences for d6cnzc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6cnzc_ a.130.1.0 (C:) automated matches {Burkholderia thailandensis [TaxId: 271848]}
ddtaltnlvalasqrlalaepvahwkwinrkpisdppreaalltdvekratangvdpaya
rtffddqiaaskqlqnalfatwrathgpegpapdlatstrpqldrltqsliaalarvapl
rdapdcpsrlarsianwktltrydsaqkdalgtalshvcaagg
Timeline for d6cnzc_: