Lineage for d6f3fa3 (6f3f A:249-529)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2979972Protein c-src tyrosine kinase [56155] (3 species)
    PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase
  7. 2980108Species Mouse (Mus musculus) [TaxId:10090] [350472] (1 PDB entry)
  8. 2980109Domain d6f3fa3: 6f3f A:249-529 [350473]
    Other proteins in same PDB: d6f3fa1, d6f3fa2, d6f3fa4
    automated match to d1fmka3
    complexed with adp, mg

Details for d6f3fa3

PDB Entry: 6f3f (more details), 2.42 Å

PDB Description: autoinhibited src kinase bound to adp
PDB Compounds: (A:) Tyrosine-protein kinase

SCOPe Domain Sequences for d6f3fa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d6f3fa3 d.144.1.7 (A:249-529) c-src tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]}
kpqtqglakdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeafl
qeaqvmkklrheklvqlyavvseepiyivteymnkgslldflkgetgkylrlpqlvdmsa
qiasgmayvermnyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpikw
tapeaalygrftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppecp
eslhdlmcqcwrkepeerptfeylqafledyftstepqyqp

SCOPe Domain Coordinates for d6f3fa3:

Click to download the PDB-style file with coordinates for d6f3fa3.
(The format of our PDB-style files is described here.)

Timeline for d6f3fa3: