SCOPe 2.08: Domain d6f3fa3: 6f3f A:249-529

Lineage for d6f3fa3 (6f3f A:249-529)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein c-src tyrosine kinase [56155] (3 species)
   PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase

7. Species Mouse (Mus musculus) [TaxId:10090] [350472] (1 PDB entry)

8. Domain d6f3fa3: 6f3f A:249-529 [350473]
   Other proteins in same PDB: d6f3fa1, d6f3fa2, d6f3fa4
   automated match to d1fmka3
   complexed with adp, mg

Details for d6f3fa3

PDB Entry: 6f3f, 2.42 Å

PDB Description: autoinhibited src kinase bound to adp

PDB Compounds: (A:) Tyrosine-protein kinase

SCOPe Domain Sequences for d6f3fa3:

Sequence; same for both SEQRES and ATOM records:

>d6f3fa3 d.144.1.7 (A:249-529) c-src tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]}
kpqtqglakdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeafl
qeaqvmkklrheklvqlyavvseepiyivteymnkgslldflkgetgkylrlpqlvdmsa
qiasgmayvermnyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpikw
tapeaalygrftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppecp
eslhdlmcqcwrkepeerptfeylqafledyftstepqyqp

Timeline for d6f3fa3:

• d6f3fa3 first appeared in SCOPe 2.07