Lineage for d6f3fa1 (6f3f A:83-145)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2783360Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 2783361Protein automated matches [190457] (10 species)
    not a true protein
  7. 2783623Species Mouse (Mus musculus) [TaxId:10090] [189303] (27 PDB entries)
  8. 2783639Domain d6f3fa1: 6f3f A:83-145 [350469]
    Other proteins in same PDB: d6f3fa2, d6f3fa3, d6f3fa4
    automated match to d1fmka1
    complexed with adp, mg

Details for d6f3fa1

PDB Entry: 6f3f (more details), 2.42 Å

PDB Description: autoinhibited src kinase bound to adp
PDB Compounds: (A:) Tyrosine-protein kinase

SCOPe Domain Sequences for d6f3fa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6f3fa1 b.34.2.0 (A:83-145) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vttfvalydyesrtetdlsfkkgerlqivnntegdwwlahslstgqtgyipsnyvapsds
iqa

SCOPe Domain Coordinates for d6f3fa1:

Click to download the PDB-style file with coordinates for d6f3fa1.
(The format of our PDB-style files is described here.)

Timeline for d6f3fa1: