| Class b: All beta proteins [48724] (180 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) ![]() |
| Family b.34.2.0: automated matches [191375] (1 protein) not a true family |
| Protein automated matches [190457] (10 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [189303] (27 PDB entries) |
| Domain d6f3fa1: 6f3f A:83-145 [350469] Other proteins in same PDB: d6f3fa2, d6f3fa3, d6f3fa4 automated match to d1fmka1 complexed with adp, mg |
PDB Entry: 6f3f (more details), 2.42 Å
SCOPe Domain Sequences for d6f3fa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6f3fa1 b.34.2.0 (A:83-145) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vttfvalydyesrtetdlsfkkgerlqivnntegdwwlahslstgqtgyipsnyvapsds
iqa
Timeline for d6f3fa1: