![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
![]() | Family b.29.1.6: Clostridium neurotoxins, the second last domain [49956] (3 proteins) automatically mapped to Pfam PF07953 |
![]() | Protein automated matches [229097] (6 species) not a true protein |
![]() | Species Clostridium botulinum [TaxId:498214] [350451] (1 PDB entry) |
![]() | Domain d6f0oa1: 6f0o A:868-1088 [350452] Other proteins in same PDB: d6f0oa2 automated match to d5jlva1 complexed with 1pe, edo, ppi |
PDB Entry: 6f0o (more details), 1.6 Å
SCOPe Domain Sequences for d6f0oa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6f0oa1 b.29.1.6 (A:868-1088) automated matches {Clostridium botulinum [TaxId: 498214]} tsilsivykkddlidlsrygakinigdrvyydsidknqiklinlesstievilknaivyn smyenfstsfwikipkyfskinlnneytiinciennsgwkvslnygeiiwtlqdnkqniq rvvfkysqmvnisdyinrwmfvtitnnrltkskiyingrlidqkpisnlgnihasnkimf kldgcrdprryimikyfnlfdkelnekeikdlydsqs
Timeline for d6f0oa1: