Lineage for d6f0oa1 (6f0o A:868-1088)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2779820Family b.29.1.6: Clostridium neurotoxins, the second last domain [49956] (3 proteins)
    automatically mapped to Pfam PF07953
  6. 2779869Protein automated matches [229097] (6 species)
    not a true protein
  7. 2779893Species Clostridium botulinum [TaxId:498214] [350451] (1 PDB entry)
  8. 2779894Domain d6f0oa1: 6f0o A:868-1088 [350452]
    Other proteins in same PDB: d6f0oa2
    automated match to d5jlva1
    complexed with 1pe, edo, ppi

Details for d6f0oa1

PDB Entry: 6f0o (more details), 1.6 Å

PDB Description: botulinum neurotoxin a3 hc domain
PDB Compounds: (A:) Bontoxilysin A

SCOPe Domain Sequences for d6f0oa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6f0oa1 b.29.1.6 (A:868-1088) automated matches {Clostridium botulinum [TaxId: 498214]}
tsilsivykkddlidlsrygakinigdrvyydsidknqiklinlesstievilknaivyn
smyenfstsfwikipkyfskinlnneytiinciennsgwkvslnygeiiwtlqdnkqniq
rvvfkysqmvnisdyinrwmfvtitnnrltkskiyingrlidqkpisnlgnihasnkimf
kldgcrdprryimikyfnlfdkelnekeikdlydsqs

SCOPe Domain Coordinates for d6f0oa1:

Click to download the PDB-style file with coordinates for d6f0oa1.
(The format of our PDB-style files is described here.)

Timeline for d6f0oa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6f0oa2