SCOPe 2.07: Domain d6f20a_: 6f20 A:

Lineage for d6f20a_ (6f20 A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (8 families)

5. Family d.113.1.1: MutT-like [55812] (17 proteins)

6. Protein 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 [103207] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [103208] (79 PDB entries)

8. Domain d6f20a_: 6f20 A: [350441]
   automated match to d1irya_
   complexed with act, c9e, gol, so4

Details for d6f20a_

PDB Entry: 6f20, 2 Å

PDB Description: complex between mth1 and compound 1 (a 7-azaindole-4-ester derivative)

PDB Compounds: (A:) 7,8-dihydro-8-oxoguanine triphosphatase

SCOPe Domain Sequences for d6f20a_:

Sequence; same for both SEQRES and ATOM records:

>d6f20a_ d.113.1.1 (A:) 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Human (Homo sapiens) [TaxId: 9606]}
mgasrlytlvlvlqpqrvllgmkkrgfgagrwngfggkvqegetiedgarrelqeesglt
vdalhkvgqivfefvgepelmdvhvfctdsiqgtpvesdemrpcwfqldqipfkdmwpdd
sywfplllqkkkfhgyfkfqgqdtildytlrevdtv

Timeline for d6f20a_:

• d6f20a_ is new in SCOPe 2.07-stable
  
• d6f20a_ appears in the current release, SCOPe 2.08