Lineage for d6f20a_ (6f20 A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. Family d.113.1.1: MutT-like [55812] (17 proteins)
  6. Protein 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 [103207] (2 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [103208] (79 PDB entries)
  8. Domain d6f20a_: 6f20 A: [350441]
    automated match to d1irya_
    complexed with act, c9e, gol, so4

Details for d6f20a_

PDB Entry: 6f20 (more details), 2 Å

PDB Description: complex between mth1 and compound 1 (a 7-azaindole-4-ester derivative)
PDB Compounds: (A:) 7,8-dihydro-8-oxoguanine triphosphatase

SCOPe Domain Sequences for d6f20a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6f20a_ d.113.1.1 (A:) 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Human (Homo sapiens) [TaxId: 9606]}
mgasrlytlvlvlqpqrvllgmkkrgfgagrwngfggkvqegetiedgarrelqeesglt
vdalhkvgqivfefvgepelmdvhvfctdsiqgtpvesdemrpcwfqldqipfkdmwpdd
sywfplllqkkkfhgyfkfqgqdtildytlrevdtv

SCOPe Domain Coordinates for d6f20a_ are not available.

Timeline for d6f20a_:

Domains from other chains:
(mouse over for more information)
d6f20b_