SCOPe 2.08: Domain d6ezfa1: 6ezf A:580-919

Lineage for d6ezfa1 (6ezf A:580-919)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families)

5. Family a.211.1.0: automated matches [191566] (1 protein)
   not a true family

6. Protein automated matches [190983] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188676] (139 PDB entries)

8. Domain d6ezfa1: 6ezf A:580-919 [350431]
   Other proteins in same PDB: d6ezfa2
   automated match to d5vp0b_
   complexed with c6z, gol, mg, na, so4, zn

Details for d6ezfa1

PDB Entry: 6ezf, 1.5 Å

PDB Description: pde2 in complex with molecule 5

PDB Compounds: (A:) cGMP-dependent 3',5'-cyclic phosphodiesterase

SCOPe Domain Sequences for d6ezfa1:

Sequence; same for both SEQRES and ATOM records:

>d6ezfa1 a.211.1.0 (A:580-919) automated matches {Human (Homo sapiens) [TaxId: 9606]}
deytkllhdgiqpvaaidsnfasftytprslpeddtsmailsmlqdmnfinnykidcptl
arfclmvkkgyrdppyhnwmhafsvshfcyllyknleltnyledieifalfiscmchdld
hrgtnnsfqvasksvlaalyssegsvmerhhfaqaiailnthgcnifdhfsrkdyqrmld
lmrdiilatdlahhlrifkdlqkmaevgydrnnkqhhrlllcllmtscdlsdqtkgwktt
rkiaeliykeffsqgdlekamgnrpmemmdrekayipelqisfmehiampiykllqdlfp
kaaelyervasnrehwtkvshkftirglpsnnsldfldee

Timeline for d6ezfa1:

• d6ezfa1 first appeared in SCOPe 2.07