Lineage for d6en6d_ (6en6 D:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. Family d.92.1.0: automated matches [191495] (1 protein)
    not a true family
  6. Protein automated matches [190805] (19 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [188286] (68 PDB entries)
  8. Domain d6en6d_: 6en6 D: [350430]
    automated match to d6en5d_
    complexed with 2pe, act, bcn, bj2, cl, edo, mg, nag, peg, pge, xpe, zn

Details for d6en6d_

PDB Entry: 6en6 (more details), 1.8 Å

PDB Description: crystal structure b of the angiotensin-1 converting enzyme n-domain in complex with a diprolyl inhibitor.
PDB Compounds: (D:) angiotensin-converting enzyme

SCOPe Domain Sequences for d6en6d_:

Sequence, based on SEQRES records: (download)

>d6en6d_ d.92.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ldpglqpgqfsadeagaqlfaqsyqssaeqvlfqsvaaswahdtnitaenarrqeeaall
sqefaeawgqkakelyepiwqqftdpqlrriigavrtlgsanlplakrqqynallsqmsr
iystakvclpqktatcwsldpdltnilassrsyamllfawegwhnaagiplkplyedfta
lsneaykqdgftdtgaywrswynsptfeddlehlyqqleplylnlhafvrralhrrygdr
yinlrgpipahllgdmwaqsweniydmvvpfpdkpnldvtstmlqqgwqathmfrvaeef
ftslelspmppefwegsmlekpadgrevvchasawdfynrkdfrikqctrvtmdqlstvh
hemghiqyylqykdlpvslrrganpgfheaigdvlalsvstpehlhkiglldrvtndtes
dinyllkmalekiaflpfgylvdqwrwgvfsgrtppsrynfdwwylrtkyqgicppvtrn
ethfdagakfhvpnvtpyiryfvsfvlqfqfhealckeagyegplhqcdiyrstkagakl
rkvlragssrpwqevlkdmvgldaldaqpllkyfqlvtqwlqeqnqqngevlgwpeyqwh
pplpdnypegidlvtdea

Sequence, based on observed residues (ATOM records): (download)

>d6en6d_ d.92.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ldpglqpgqfsadeagaqlfaqsyqssaeqvlfqsvaaswahdtnitaenarrqeeaall
sqefaeawgqkakelyepiwqqftdpqlrriigavrtlgsanlplakrqqynallsqmsr
iystakvclpqcwsldpdltnilassrsyamllfawegwhnaagiplkplyedftalsne
aykqdgftdtgaywrswynsptfeddlehlyqqleplylnlhafvrralhrrygdryinl
rgpipahllgdmwaqsweniydmvvpfpdkpnldvtstmlqqgwqathmfrvaeefftsl
elspmppefwegsmlekpadgrevvchasawdfynrkdfrikqctrvtmdqlstvhhemg
hiqyylqykdlpvslrrganpgfheaigdvlalsvstpehlhkiglldrvtndtesdiny
llkmalekiaflpfgylvdqwrwgvfsgrtppsrynfdwwylrtkyqgicppvtrnethf
dagakfhvpnvtpyiryfvsfvlqfqfhealckeagyegplhqcdiyrstkagaklrkvl
ragssrpwqevlkdmvgldaldaqpllkyfqlvtqwlqeqnqqngevlgwpeyqwhpplp
dnypegidlvtdea

SCOPe Domain Coordinates for d6en6d_ are not available.

Timeline for d6en6d_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6en6a_, d6en6b_, d6en6c_