SCOPe 2.08: Domain d6f28a_: 6f28 A:

Lineage for d6f28a_ (6f28 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (161 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [186759] (113 PDB entries)

8. Domain d6f28a_: 6f28 A: [350427]
   automated match to d3u92a_
   complexed with cg8, cl, so4, zn

Details for d6f28a_

PDB Entry: 6f28, 2.4 Å

PDB Description: crystal structure of the kainate receptor gluk3 ligand binding domain in complex with (s)-1-[2'-amino-2'-carboxyethyl]-6-methyl-5,7- dihydropyrrolo[3,4-d]pyrimidin-2,4(1h,3h)-dione at resolution 2.4a

PDB Compounds: (A:) Glutamate receptor ionotropic, kainate 3,Glutamate receptor ionotropic, kainate 3

SCOPe Domain Sequences for d6f28a_:

Sequence; same for both SEQRES and ATOM records:

>d6f28a_ c.94.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nrslivttlleepfvmfrksdrtlygndrfegycidllkelahilgfsyeirlvedgkyg
aqddkgqwngmvkelidhkadlavapltithvrekaidfskpfmtlgvsilyrkgtpids
addlakqtkieygavkdgatmtffkkskistfekmwafmsskpsalvknneegiqrtlta
dyallmesttieyitqrncnltqigglidskgygigtpmgspyrdkitiailqlqeedkl
himkekwwrgsgcp

Timeline for d6f28a_:

• d6f28a_ first appeared in SCOPe 2.07