| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein automated matches [190374] (15 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries) |
| Domain d6elui2: 6elu I:112-217 [350410] Other proteins in same PDB: d6elub_, d6eluc1, d6elue_, d6eluf1, d6eluh_, d6elui1, d6eluk_, d6elul1 automated match to d2fd6l2 |
PDB Entry: 6elu (more details), 2.3 Å
SCOPe Domain Sequences for d6elui2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6elui2 b.1.1.2 (I:112-217) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne
Timeline for d6elui2: