SCOP 1.63: Domain d1wala_: 1wal A:

Lineage for d1wala_ (1wal A:)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.77: Isocitrate/Isopropylmalate dehydrogenases [53658] (1 superfamily)
   consists of two intertwined (sub)domains related by pseudodyad; duplication
   3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest

4. Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenases [53659] (2 families)

5. Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (3 proteins)
   the active site is between the two identical subunits

6. Protein 3-isopropylmalate dehydrogenase, IPMDH [53661] (6 species)

7. Species Thermus thermophilus [TaxId:274] [53662] (14 PDB entries)

8. Domain d1wala_: 1wal A: [35041]
   mutant

Details for d1wala_

PDB Entry: 1wal, 2.27 Å

PDB Description: 3-isopropylmalate dehydrogenase (ipmdh) mutant (m219a)from thermus thermophilus

SCOP Domain Sequences for d1wala_:

Sequence; same for both SEQRES and ATOM records:

>d1wala_ c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPMDH {Thermus thermophilus}
mkvavlpgdgigpevteaalkvlraldeaeglglayevfpfggaaidafgepfpeptrkg
veeaeavllgsvggpkwdglprkispetgllslrksqdlfanlrpakvfpglerlsplke
eiargvdvlivreltggiyfgeprgmseaeawnteryskpevervarvafeaarkrrkhv
vsvdkanvlevgefwrktveevgrgypdvalehqyvdaaamhlvrsparfdvvvtgnifg
dilsdlasvlpgslgllpsaslgrgtpvfepvhgsapdiagkgianptaailsaammleh
afglvelarkvedavakalletpppdlggsagteaftatvlrhla

Timeline for d1wala_:

• d1wala_ first appeared (with stable ids) in SCOP 1.55
  
• d1wala_ appears in SCOP 1.61
  
• d1wala_ appears in SCOP 1.65
  
• d1wala_ appears in the current release, SCOPe 2.08