Lineage for d1wala_ (1wal A:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 74327Fold c.77: Isocitrate & isopropylmalate dehydrogenases [53658] (1 superfamily)
  4. 74328Superfamily c.77.1: Isocitrate & isopropylmalate dehydrogenases [53659] (1 family) (S)
  5. 74329Family c.77.1.1: Isocitrate & isopropylmalate dehydrogenases [53660] (2 proteins)
  6. 74330Protein 3-isopropylmalate dehydrogenase, IPMDH [53661] (6 species)
  7. 74343Species Thermus thermophilus [TaxId:274] [53662] (14 PDB entries)
  8. 74352Domain d1wala_: 1wal A: [35041]

Details for d1wala_

PDB Entry: 1wal (more details), 2.27 Å

PDB Description: 3-isopropylmalate dehydrogenase (ipmdh) mutant (m219a)from thermus thermophilus

SCOP Domain Sequences for d1wala_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wala_ c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPMDH {Thermus thermophilus}
mkvavlpgdgigpevteaalkvlraldeaeglglayevfpfggaaidafgepfpeptrkg
veeaeavllgsvggpkwdglprkispetgllslrksqdlfanlrpakvfpglerlsplke
eiargvdvlivreltggiyfgeprgmseaeawnteryskpevervarvafeaarkrrkhv
vsvdkanvlevgefwrktveevgrgypdvalehqyvdaaamhlvrsparfdvvvtgnifg
dilsdlasvlpgslgllpsaslgrgtpvfepvhgsapdiagkgianptaailsaammleh
afglvelarkvedavakalletpppdlggsagteaftatvlrhla

SCOP Domain Coordinates for d1wala_:

Click to download the PDB-style file with coordinates for d1wala_.
(The format of our PDB-style files is described here.)

Timeline for d1wala_: