Lineage for d6f0pa2 (6f0p A:1099-1300)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2791605Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2792430Superfamily b.42.4: STI-like [50386] (3 families) (S)
  5. 2792493Family b.42.4.2: Clostridium neurotoxins, C-terminal domain [50399] (3 proteins)
    overall fold is very similar to that of the STI family
    automatically mapped to Pfam PF07951
  6. 2792542Protein automated matches [229100] (6 species)
    not a true protein
  7. 2792543Species Clostridium botulinum [TaxId:1491] [229101] (14 PDB entries)
  8. 2792545Domain d6f0pa2: 6f0p A:1099-1300 [350402]
    Other proteins in same PDB: d6f0pa1
    automated match to d5jlva2
    complexed with btb, edo, ni, peg

Details for d6f0pa2

PDB Entry: 6f0p (more details), 1.34 Å

PDB Description: botulinum neurotoxin a4 hc domain
PDB Compounds: (A:) Neurotoxin type A

SCOPe Domain Sequences for d6f0pa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6f0pa2 b.42.4.2 (A:1099-1300) automated matches {Clostridium botulinum [TaxId: 1491]}
nsgilkdfwgdylqydksyymlnlydpnkyvdvnnvgirgymylkgprdnvmttniylns
slymgtkfiikkyasgnkdnivrnndrvyinvvvknkeyrlatnasqagvekilsaleip
dvgnlsqvvvmkskndqgitnkckmnlqdnngndigfigfhqfnniaklvasnwynrqie
rssrtlgcswefipvddgwrer

SCOPe Domain Coordinates for d6f0pa2:

Click to download the PDB-style file with coordinates for d6f0pa2.
(The format of our PDB-style files is described here.)

Timeline for d6f0pa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6f0pa1