Class b: All beta proteins [48724] (180 folds) |
Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.4: STI-like [50386] (3 families) |
Family b.42.4.2: Clostridium neurotoxins, C-terminal domain [50399] (3 proteins) overall fold is very similar to that of the STI family automatically mapped to Pfam PF07951 |
Protein automated matches [229100] (6 species) not a true protein |
Species Clostridium botulinum [TaxId:1491] [229101] (14 PDB entries) |
Domain d6f0pa2: 6f0p A:1099-1300 [350402] Other proteins in same PDB: d6f0pa1 automated match to d5jlva2 complexed with btb, edo, ni, peg |
PDB Entry: 6f0p (more details), 1.34 Å
SCOPe Domain Sequences for d6f0pa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6f0pa2 b.42.4.2 (A:1099-1300) automated matches {Clostridium botulinum [TaxId: 1491]} nsgilkdfwgdylqydksyymlnlydpnkyvdvnnvgirgymylkgprdnvmttniylns slymgtkfiikkyasgnkdnivrnndrvyinvvvknkeyrlatnasqagvekilsaleip dvgnlsqvvvmkskndqgitnkckmnlqdnngndigfigfhqfnniaklvasnwynrqie rssrtlgcswefipvddgwrer
Timeline for d6f0pa2: