Lineage for d6evia_ (6evi A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2738143Fold a.245: EB1 dimerisation domain-like [140611] (1 superfamily)
    dimeric 4-helical bundle with a coiled coil at one end formed by the longer N-terminal helices
  4. 2738144Superfamily a.245.1: EB1 dimerisation domain-like [140612] (1 family) (S)
  5. 2738145Family a.245.1.1: EB1 dimerisation domain-like [140613] (2 proteins)
    Pfam PF03271
  6. 2738146Protein Microtubule-associated protein EB1, C-terminal dimerization domain [140614] (2 species)
  7. 2738186Species Mouse (Mus musculus) [TaxId:10090] [350342] (2 PDB entries)
  8. 2738187Domain d6evia_: 6evi A: [350384]
    automated match to d1wu9b_

Details for d6evia_

PDB Entry: 6evi (more details)

PDB Description: solution nmr structure of eb1 c terminus (191-260)
PDB Compounds: (A:) Microtubule-associated protein RP/EB family member 1

SCOPe Domain Sequences for d6evia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6evia_ a.245.1.1 (A:) Microtubule-associated protein EB1, C-terminal dimerization domain {Mouse (Mus musculus) [TaxId: 10090]}
deaaelmqqvkvlkltvedlekerdfyfgklrnielicqenegendpvlqrivdilyatd
egfvipdegg

SCOPe Domain Coordinates for d6evia_:

Click to download the PDB-style file with coordinates for d6evia_.
(The format of our PDB-style files is described here.)

Timeline for d6evia_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6evib_