Lineage for d6cqhb_ (6cqh B:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. Protein automated matches [190417] (36 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187294] (1454 PDB entries)
  8. Domain d6cqhb_: 6cqh B: [350376]
    automated match to d6bu6a_
    complexed with act, cl, f8y, gol, so4

Details for d6cqhb_

PDB Entry: 6cqh (more details), 2.15 Å

PDB Description: crystal structure of the human vaccinia-related kinase bound to a n- propynyl-n-ethyl-dihydropteridine inhibitor
PDB Compounds: (B:) Serine/threonine-protein kinase VRK1

SCOPe Domain Sequences for d6cqhb_:

Sequence, based on SEQRES records: (download)

>d6cqhb_ d.144.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qfavgeiitdmaaaawkvglpigqggfgciyladmnssesvgsdapcvvkvepsdngplf
telkfyqraakpeqiqkwirtrklkylgvpkywgsglhdkngksyrfmimdrfgsdlqki
yeanakrfsrktvlqlslrildileyiheheyvhgdikasnlllnyknpdqvylvdygla
yrycpegvhkayaadpkrchdgtieftsidahngvapsrrgdleilgycmiqwltghlpw
ednlkdpkyvrdskiryreniaslmdkcfpaanapgeiakymetvklldytekplyenlr
dillqglkaigskddgkldl

Sequence, based on observed residues (ATOM records): (download)

>d6cqhb_ d.144.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qfavgeiitdmaaaawkvglpigqggfgciyladmnssesvgsdapcvvkvepsdngplf
telkfyqraakpeqiqkwirtrklkylgvpkywgsglhdsyrfmimdrfgsdlqkiyean
akrfsrktvlqlslrildileyiheheyvhgdikasnlllnyknpdqvylvdyglayryc
pegvhkayaadpkrchdgtieftsidahngvapsrrgdleilgycmiqwltghlpwednl
kdpkyvrdskiryreniaslmdkcfpaanapgeiakymetvklldytekplyenlrdill
qglkaigskddgkldl

SCOPe Domain Coordinates for d6cqhb_ are not available.

Timeline for d6cqhb_:

Domains from other chains:
(mouse over for more information)
d6cqha_, d6cqhc_, d6cqhd_