Lineage for d6ctyb_ (6cty B:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. Family c.1.9.0: automated matches [191327] (1 protein)
    not a true family
  6. Protein automated matches [190150] (36 species)
    not a true protein
  7. Species Yersinia pestis [TaxId:632] [331414] (1 PDB entry)
  8. Domain d6ctyb_: 6cty B: [350375]
    Other proteins in same PDB: d6ctyc2
    automated match to d4lfyb_
    complexed with mlt, zn

Details for d6ctyb_

PDB Entry: 6cty (more details), 2.4099999999999997 Å

PDB Description: crystal structure of dihydroorotase pyrc from yersinia pestis in complex with zinc and malate at 2.4 a resolution
PDB Compounds: (B:) dihydroorotase

SCOPe Domain Sequences for d6ctyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ctyb_ c.1.9.0 (B:) automated matches {Yersinia pestis [TaxId: 632]}
pqtlkirrpddwhihlrddemlstvlpytsevfaraivmpnlaqpittvasaiayreril
aavpaghkftplmtcyltnsldakelttgfeqgvftaaklypanattnsthgvsdipaiy
plfeqmqkigmpllihgevtdaavdifdrearfidqilepirqkfpelkivfehittkda
adyvlagnrflgatvtpqhlmfnrnhmlvggirphlfclpilkrsthqqalraavasgsd
rfflgtdsaphakhrkesscgcagvfnapaalpayasvfeelnalqhleafcalngprfy
glpvnddvvelvrtpflqpeeiplgnesvipflagqtlnwsvk

SCOPe Domain Coordinates for d6ctyb_ are not available.

Timeline for d6ctyb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6ctya_, d6ctyc1, d6ctyc2, d6ctyd_, d6ctye_, d6ctyf_