SCOPe 2.08: Domain d6essa1: 6ess A:14-134

Lineage for d6essa1 (6ess A:14-134)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein automated matches [190191] (2 species)
   not a true protein

7. Species Streptomyces avidinii [TaxId:1895] [189343] (100 PDB entries)

8. Domain d6essa1: 6ess A:14-134 [350357]
   Other proteins in same PDB: d6essa2
   automated match to d2bc3b_
   complexed with 4ir, ir; mutant

Details for d6essa1

PDB Entry: 6ess, 1.91 Å

PDB Description: artificial imine reductase mutant s112a-n118p-k121a-s122m

PDB Compounds: (A:) streptavidin

SCOPe Domain Sequences for d6essa1:

Sequence; same for both SEQRES and ATOM records:

>d6essa1 b.61.1.1 (A:14-134) automated matches {Streptomyces avidinii [TaxId: 1895]}
eagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtal
gwtvawknnyrnahsattwsgqyvggaearintqwlltagtteapawamtlvghdtftkv
k

Timeline for d6essa1:

• d6essa1 first appeared in SCOPe 2.07