Lineage for d6eu9b_ (6eu9 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2728284Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2728285Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2729960Family a.123.1.0: automated matches [191623] (1 protein)
    not a true family
  6. 2729961Protein automated matches [191142] (5 species)
    not a true protein
  7. 2729974Species Human (Homo sapiens) [TaxId:9606] [189274] (121 PDB entries)
  8. 2730163Domain d6eu9b_: 6eu9 B: [350356]
    automated match to d4dm6b_
    complexed with rea

Details for d6eu9b_

PDB Entry: 6eu9 (more details), 2.69 Å

PDB Description: crystal structure of platynereis dumerilii rar ligand-binding domain in complex with all-trans retinoic acid
PDB Compounds: (B:) retinoic acid receptor

SCOPe Domain Sequences for d6eu9b_:

Sequence, based on SEQRES records: (download)

>d6eu9b_ a.123.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eltedeeemvekilkaheetfpyltdddkyrltqeelekgnvilwervselstkaianvv
dfgkqvpvftqlstndqitllkaacleiiilrlasryddkedtmsfsngltltqqqlevg
gfgtltptifkfarslvelsvdtaeyamlsliclisgdrsglehpekveqkqepiletlk
hyvrkrrpdsphsfaklllkltdlrslsvkgaervlqlrmempgelpplilemld

Sequence, based on observed residues (ATOM records): (download)

>d6eu9b_ a.123.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eltedeeemvekilkaheetfpyltdddkyrltqilwervselstkaianvvdfgkqvpv
ftqlstndqitllkaacleiiilrlasryddkedtmsfsngltltqqqlevggfgtltpt
ifkfarslvelsvdtaeyamlsliclisgdrsglehpekveqkqepiletlkhyvrkrrp
dsphsfaklllkltdlrslsvkgaervlqlrmempgelpplilemld

SCOPe Domain Coordinates for d6eu9b_:

Click to download the PDB-style file with coordinates for d6eu9b_.
(The format of our PDB-style files is described here.)

Timeline for d6eu9b_: