SCOPe 2.08: Domain d6c6xf2: 6c6x F:107-214

Lineage for d6c6xf2 (6c6x F:107-214)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [226133] (37 PDB entries)

8. Domain d6c6xf2: 6c6x F:107-214 [350355]
   Other proteins in same PDB: d6c6xa2, d6c6xc2, d6c6xe2, d6c6xh2
   automated match to d1dn0a2

Details for d6c6xf2

PDB Entry: 6c6x, 1.99 Å

PDB Description: crystal structure of middle-east respiratory syndrome (mers) coronavirus neutralizing antibody jc57-14 isolated from a vaccinated rhesus macaque.

PDB Compounds: (F:) JC57-14 Light chain

SCOPe Domain Sequences for d6c6xf2:

Sequence; same for both SEQRES and ATOM records:

>d6c6xf2 b.1.1.0 (F:107-214) automated matches {Rhesus monkey (Macaca mulatta) [TaxId: 9544]}
krtvaapsvfifppsedqvksgtvsvvcllnnfypreasvkwkvdgalktgnsqesvteq
dskdntyslsstltlssteyqshkvyacevthqglsspvtksfnrgec

Timeline for d6c6xf2:

• d6c6xf2 first appeared in SCOPe 2.07