Lineage for d1idm__ (1idm -)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 27255Fold c.77: Isocitrate & isopropylmalate dehydrogenases [53658] (1 superfamily)
  4. 27256Superfamily c.77.1: Isocitrate & isopropylmalate dehydrogenases [53659] (1 family) (S)
  5. 27257Family c.77.1.1: Isocitrate & isopropylmalate dehydrogenases [53660] (2 proteins)
  6. 27258Protein 3-isopropylmalate dehydrogenase, IPMDH [53661] (6 species)
  7. 27271Species Thermus thermophilus [TaxId:274] [53662] (14 PDB entries)
  8. 27274Domain d1idm__: 1idm - [35035]

Details for d1idm__

PDB Entry: 1idm (more details), 2.1 Å

PDB Description: 3-isopropylmalate dehydrogenase, loop-deleted chimera

SCOP Domain Sequences for d1idm__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1idm__ c.77.1.1 (-) 3-isopropylmalate dehydrogenase, IPMDH {Thermus thermophilus}
mkvavlpgdgigpevteaalkvlraldeaeglglayevfpfggaaidafgepfpeptrkg
veeaeavllgsvggpkwgtgsvrpeqgllslrksqdlfanlrpakvfpglerlsplkeei
argvdvlivreltggiyfgeprgmseaeawnteryskpevervarvafeaarkrrkhvvs
vdkanvlevgefwrktveevgrgypdvalehqyvdamamhlvrsparfdvvvtgnifgdi
lsdlasvlpgslgllpsaslgrgtpvfepvhgsapdiagkgianptaailsaammlehaf
glvelarkvedavakalletpppdlggsagteaftatvlrhla

SCOP Domain Coordinates for d1idm__:

Click to download the PDB-style file with coordinates for d1idm__.
(The format of our PDB-style files is described here.)

Timeline for d1idm__: