SCOPe 2.08: Domain d6eluf1: 6elu F:1-111

Lineage for d6eluf1 (6elu F:1-111)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d6eluf1: 6elu F:1-111 [350336]
   Other proteins in same PDB: d6elub_, d6eluc2, d6elue_, d6eluf2, d6eluh_, d6elui2, d6eluk_, d6elul2
   automated match to d2fd6l1

Details for d6eluf1

PDB Entry: 6elu, 2.3 Å

PDB Description: structure of serum resistance associated protein from t. b. rhodesiense

PDB Compounds: (F:) G10_3 Light chain

SCOPe Domain Sequences for d6eluf1:

Sequence; same for both SEQRES and ATOM records:

>d6eluf1 b.1.1.0 (F:1-111) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divmtqtppslavslgqratisckasqsvdydadsfmhwyqqkpgqppklliyaasnles
giparfsgsgsgtdftlnirpveeedaatyycqqsnedpwtfgggtkleik

Timeline for d6eluf1:

• d6eluf1 first appeared in SCOPe 2.07