![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (31 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries) |
![]() | Domain d6eluf1: 6elu F:1-111 [350336] Other proteins in same PDB: d6elub_, d6eluc2, d6elue_, d6eluf2, d6eluh_, d6elui2, d6eluk_, d6elul2 automated match to d2fd6l1 |
PDB Entry: 6elu (more details), 2.3 Å
SCOPe Domain Sequences for d6eluf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6eluf1 b.1.1.0 (F:1-111) automated matches {Mouse (Mus musculus) [TaxId: 10090]} divmtqtppslavslgqratisckasqsvdydadsfmhwyqqkpgqppklliyaasnles giparfsgsgsgtdftlnirpveeedaatyycqqsnedpwtfgggtkleik
Timeline for d6eluf1: