![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
![]() | Superfamily d.113.1: Nudix [55811] (8 families) ![]() |
![]() | Family d.113.1.1: MutT-like [55812] (17 proteins) |
![]() | Protein 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 [103207] (2 species) |
![]() | Species Mus musculus [TaxId:10090] [346571] (3 PDB entries) |
![]() | Domain d6ehhd_: 6ehh D: [350331] automated match to d5ws7a_ complexed with 2ge, cu, gol, mg, no3, peg; mutant |
PDB Entry: 6ehh (more details), 2.4 Å
SCOPe Domain Sequences for d6ehhd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ehhd_ d.113.1.1 (D:) 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Mus musculus [TaxId: 10090]} tsrlytlvlvlqpqrvllgmkkrgfgagrwngfggkvqegetiedgakrelleesglsvd tlhkvghisfefvgspelmdvhifsadhvhgtpteseemrpqwfqldqipfadmwpddsy wfplllqkkkfcghfkfqdqdtilsyslrevdsf
Timeline for d6ehhd_: