Lineage for d6cnze_ (6cnz E:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.130: Chorismate mutase II [48599] (1 superfamily)
    multihelical; core: 6 helices, bundle
  4. Superfamily a.130.1: Chorismate mutase II [48600] (5 families) (S)
  5. Family a.130.1.0: automated matches [237401] (1 protein)
    not a true family
  6. Protein automated matches [237402] (7 species)
    not a true protein
  7. Species Burkholderia thailandensis [TaxId:271848] [237403] (1 PDB entry)
  8. Domain d6cnze_: 6cnz E: [350330]
    automated match to d4oj7c_
    complexed with edo, no3

Details for d6cnze_

PDB Entry: 6cnz (more details), 2.15 Å

PDB Description: crystal structure of chorismate mutase from burkholderia thailandensis
PDB Compounds: (E:) chorismate mutase

SCOPe Domain Sequences for d6cnze_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cnze_ a.130.1.0 (E:) automated matches {Burkholderia thailandensis [TaxId: 271848]}
gddtaltnlvalasqrlalaepvahwkwinrkpisdppreaalltdvekratangvdpay
artffddqiaaskqlqnalfatwrathgpegpapdlatstrpqldrltqsliaalarvap
lrdapdcpsrlarsianwktltrydsaqkdalgtalshvc

SCOPe Domain Coordinates for d6cnze_ are not available.

Timeline for d6cnze_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6cnza_, d6cnzb_, d6cnzc_, d6cnzd_, d6cnzf_