Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily) consists of two intertwined (sub)domains related by pseudo dyad; duplication 3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest |
Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) the constituent families form similar dimers |
Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins) the active site is between the two identical subunits |
Protein 3-isopropylmalate dehydrogenase, IPMDH [53661] (11 species) |
Species Thermus thermophilus [TaxId:274] [53662] (14 PDB entries) |
Domain d1xaaa_: 1xaa A: [35033] |
PDB Entry: 1xaa (more details), 2.1 Å
SCOPe Domain Sequences for d1xaaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xaaa_ c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPMDH {Thermus thermophilus [TaxId: 274]} mkvavlpgdgigpevteaalkvlraldeaeglglayevfpfggaaidafgepfpeptrkg veeaeavllgsvggpkwdglprkirpetgllslrksqdlfanlrpakvfpglerlsplke eiargvdvlivreltggiyfgeprgmseaeawnteryskpevervarvafeaarkrrkhv vsvdkanvlevgefwrktveevgrgypdvalehqyvdamamhlvrsparfdvvvtgnifg dilsdlasvlpgslgllpsaslgrgtpvfepvhgsapdiagkgianptaailsaammleh afglvelarkvedavakalletpppdlggsagteaftatvlrhla
Timeline for d1xaaa_: