Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
Family c.1.9.0: automated matches [191327] (1 protein) not a true family |
Protein automated matches [190150] (36 species) not a true protein |
Species Yersinia pestis [TaxId:632] [331414] (1 PDB entry) |
Domain d6ctyf_: 6cty F: [350315] Other proteins in same PDB: d6ctyc2 automated match to d4lfyb_ complexed with mlt, zn |
PDB Entry: 6cty (more details), 2.41 Å
SCOPe Domain Sequences for d6ctyf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ctyf_ c.1.9.0 (F:) automated matches {Yersinia pestis [TaxId: 632]} pqtlkirrpddwhihlrddemlstvlpytsevfaraivmpnlaqpittvasaiayreril aavpaghkftplmtcyltnsldakelttgfeqgvftaaklypanattnsthgvsdipaiy plfeqmqkigmpllihgevtdaavdifdrearfidqilepirqkfpelkivfehittkda adyvlagnrflgatvtpqhlmfnrnhmlvggirphlfclpilkrsthqqalraavasgsd rfflgtdsaphakhrkesscgcagvfnapaalpayasvfeelnalqhleafcalngprfy glpvnddvvelvrtpflqpeeiplgnesvipflagqtlnwsvkr
Timeline for d6ctyf_: