SCOPe 2.08: Domain d6ck7b1: 6ck7 B:1-170

Lineage for d6ck7b1 (6ck7 B:1-170)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.167: Peptide deformylase [56419] (1 superfamily)
   alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix

4. Superfamily d.167.1: Peptide deformylase [56420] (2 families)
   nickel-dependent enzyme

5. Family d.167.1.0: automated matches [191587] (1 protein)
   not a true family

6. Protein automated matches [191055] (20 species)
   not a true protein

7. Species Legionella pneumophila [TaxId:446] [350187] (1 PDB entry)

8. Domain d6ck7b1: 6ck7 B:1-170 [350313]
   Other proteins in same PDB: d6ck7a2, d6ck7b2, d6ck7c2, d6ck7d2
   automated match to d3qu1a_
   complexed with bb2, so4, zn

Details for d6ck7b1

PDB Entry: 6ck7, 1.65 Å

PDB Description: crystal structure of a peptide deformylase from legionella pneumophila bound to actinonin

PDB Compounds: (B:) Peptide deformylase

SCOPe Domain Sequences for d6ck7b1:

Sequence; same for both SEQRES and ATOM records:

>d6ck7b1 d.167.1.0 (B:1-170) automated matches {Legionella pneumophila [TaxId: 446]}
mairkilylpderlrkiakpvetfdeslqtlindmfdtmydargvglaapqigvslrlsv
idivgdkkeqivivnpeivsshgekefeegclsvpgaydtvvraekvtvkaldrfgkpfe
itgegllaeclqheidhmngklfvdmlsplkrmmarrkldkfkrlqarkp

Timeline for d6ck7b1:

• d6ck7b1 first appeared in SCOPe 2.07