Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
Protein automated matches [190151] (166 species) not a true protein |
Species Legionella pneumophila [TaxId:272624] [350056] (4 PDB entries) |
Domain d6cjba_: 6cjb A: [350312] automated match to d5dx5a_ complexed with fmt, gol, llp |
PDB Entry: 6cjb (more details), 1.75 Å
SCOPe Domain Sequences for d6cjba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6cjba_ c.67.1.0 (A:) automated matches {Legionella pneumophila [TaxId: 272624]} kthfdtraihagqepckstgavmtpiyatstykqiapgehlgyeysrtqnptrkayedci aslesgqkgfafasgmaaintvidllgsgdhvvamddlyggtfrlfdkvktrtsnlsfsf idmsvpenieaaitpktkllwletpsnpmlklanlrkiaaiakkynlitvadntfatpwi qrplelgfdivlhsatkylnghsdvvsgvvvvgdnsvlsdkiaflqnscgavagpfdsfl vlrslktlsvrmqrhcenanhlanwlsshpkiekviypglkshpqyslakeqmnnfggmi slvlkgsledakrflarcelftlaeslggvesliehpaimthasipveqrkalgiedgfi rlsvgiehiddlradlehalg
Timeline for d6cjba_: