Lineage for d6cond_ (6con D:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2529545Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 2529546Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) (S)
  5. 2529832Family c.124.1.0: automated matches [191609] (1 protein)
    not a true family
  6. 2529833Protein automated matches [191112] (16 species)
    not a true protein
  7. 2529941Species Mycobacterium tuberculosis [TaxId:1773] [350191] (1 PDB entry)
  8. 2529943Domain d6cond_: 6con D: [350311]
    automated match to d5n00b_

Details for d6cond_

PDB Entry: 6con (more details), 2.1 Å

PDB Description: crystal structure of mycobacterium tuberculosis ipdab
PDB Compounds: (D:) CoA-transferase subunit beta

SCOPe Domain Sequences for d6cond_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cond_ c.124.1.0 (D:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
straevcavacaelfrdageimispmtnmasvgarlarltfapdilltdgeaqlladtpa
lgktgapnriegwmpfgrvfetlawgrrhvvmganqvdrygnqnisafgplqrptrqmfg
vrgspgntinhatsywvgnhckrvfveavdvvsgigydkvdpdnpafrfvnvyrvvsnlg
vfdfggpdhsmravslhpgvtpgdvrdatsfevhdldaaeqtrlptddelhliravidpk
slrdreirs

SCOPe Domain Coordinates for d6cond_:

Click to download the PDB-style file with coordinates for d6cond_.
(The format of our PDB-style files is described here.)

Timeline for d6cond_: