Lineage for d1auka_ (1auk A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1873372Fold c.76: Alkaline phosphatase-like [53648] (1 superfamily)
    core:3 layers: a/b/a; mixed beta-sheet of 8 strands, order 43516728, strand 7 is antiparallel to the rest
  4. 1873373Superfamily c.76.1: Alkaline phosphatase-like [53649] (6 families) (S)
  5. 1873491Family c.76.1.2: Arylsulfatase [53653] (4 proteins)
    includes additional C-terminal alpha+beta (sub)domain
  6. 1873492Protein Arylsulfatase A [53654] (1 species)
  7. 1873493Species Human (Homo sapiens) [TaxId:9606] [53655] (7 PDB entries)
  8. 1873494Domain d1auka_: 1auk A: [35030]
    complexed with mg

Details for d1auka_

PDB Entry: 1auk (more details), 2.1 Å

PDB Description: human arylsulfatase a
PDB Compounds: (A:) arylsulfatase a

SCOPe Domain Sequences for d1auka_:

Sequence, based on SEQRES records: (download)

>d1auka_ c.76.1.2 (A:) Arylsulfatase A {Human (Homo sapiens) [TaxId: 9606]}
rppnivlifaddlgygdlgcyghpssttpnldqlaagglrftdfyvpvslgtpsraallt
grlpvrmgmypgvlvpssrgglpleevtvaevlaargyltgmagkwhlgvgpegaflpph
qgfhrflgipyshdqgpcqnltcfppatpcdggcdqglvpipllanlsveaqppwlpgle
arymafahdlmadaqrqdrpfflyyashhthypqfsgqsfaersgrgpfgdslmeldaav
gtlmtaigdlglleetlviftadngpetmrmsrggcsgllrcgkgttyeggvrepalafw
pghiapgvthelassldllptlaalagaplpnvtldgfdlsplllgtgksprqslffyps
ypdevrgvfavrtgkykahfftqgsahsdttadpachasssltaheppllydlskdpgen
ynllggvagatpevlqalkqlqllkaqldaavtfgpsqvargedpalqicchpgctprpa
cchcp

Sequence, based on observed residues (ATOM records): (download)

>d1auka_ c.76.1.2 (A:) Arylsulfatase A {Human (Homo sapiens) [TaxId: 9606]}
rppnivlifaddlgygdlgcyghpssttpnldqlaagglrftdfyvpvslgtpsraallt
grlpvrmgmypgvlvpssrgglpleevtvaevlaargyltgmagkwhlgvgpegaflpph
qgfhrflgipyshdqgpcqnltcfppatpcdggcdqglvpipllanlsveaqppwlpgle
arymafahdlmadaqrqdrpfflyyashhthypqfsgqsfaersgrgpfgdslmeldaav
gtlmtaigdlglleetlviftadngpetmrmsrggcsgllrcgkgttyeggvrepalafw
pghiapgvthelassldllptlaalagaplpnvtldgfdlsplllgtgksprqslffyps
ypdevrgvfavrtgkykahfftqgsahsdttadpachasssltaheppllydlskdpgen
ynllgatpevlqalkqlqllkaqldaavtfgpsqvargedpalqicchpgctprpacchc
p

SCOPe Domain Coordinates for d1auka_:

Click to download the PDB-style file with coordinates for d1auka_.
(The format of our PDB-style files is described here.)

Timeline for d1auka_: