Lineage for d1auk__ (1auk -)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 249394Fold c.76: Alkaline phosphatase-like [53648] (1 superfamily)
    core:3 layers: a/b/a; mixed beta-sheet of 8 strands, order 43516728, strand 7 is antiparallel to the rest
  4. 249395Superfamily c.76.1: Alkaline phosphatase-like [53649] (3 families) (S)
  5. 249466Family c.76.1.2: Arylsulfatase [53653] (2 proteins)
    includes additional C-terminal alpha+beta (sub)domain
  6. 249467Protein Arylsulfatase A [53654] (1 species)
  7. 249468Species Human (Homo sapiens) [TaxId:9606] [53655] (5 PDB entries)
  8. 249469Domain d1auk__: 1auk - [35030]
    complexed with fgl, mg, nag

Details for d1auk__

PDB Entry: 1auk (more details), 2.1 Å

PDB Description: human arylsulfatase a

SCOP Domain Sequences for d1auk__:

Sequence, based on SEQRES records: (download)

>d1auk__ c.76.1.2 (-) Arylsulfatase A {Human (Homo sapiens)}
rppnivlifaddlgygdlgcyghpssttpnldqlaagglrftdfyvpvslctpsraallt
grlpvrmgmypgvlvpssrgglpleevtvaevlaargyltgmagkwhlgvgpegaflpph
qgfhrflgipyshdqgpcqnltcfppatpcdggcdqglvpipllanlsveaqppwlpgle
arymafahdlmadaqrqdrpfflyyashhthypqfsgqsfaersgrgpfgdslmeldaav
gtlmtaigdlglleetlviftadngpetmrmsrggcsgllrcgkgttyeggvrepalafw
pghiapgvthelassldllptlaalagaplpnvtldgfdlsplllgtgksprqslffyps
ypdevrgvfavrtgkykahfftqgsahsdttadpachasssltaheppllydlskdpgen
ynllggvagatpevlqalkqlqllkaqldaavtfgpsqvargedpalqicchpgctprpa
cchcp

Sequence, based on observed residues (ATOM records): (download)

>d1auk__ c.76.1.2 (-) Arylsulfatase A {Human (Homo sapiens)}
rppnivlifaddlgygdlgcyghpssttpnldqlaagglrftdfyvpvslctpsraallt
grlpvrmgmypgvlvpssrgglpleevtvaevlaargyltgmagkwhlgvgpegaflpph
qgfhrflgipyshdqgpcqnltcfppatpcdggcdqglvpipllanlsveaqppwlpgle
arymafahdlmadaqrqdrpfflyyashhthypqfsgqsfaersgrgpfgdslmeldaav
gtlmtaigdlglleetlviftadngpetmrmsrggcsgllrcgkgttyeggvrepalafw
pghiapgvthelassldllptlaalagaplpnvtldgfdlsplllgtgksprqslffyps
ypdevrgvfavrtgkykahfftqgsahsdttadpachasssltaheppllydlskdpgen
ynllgatpevlqalkqlqllkaqldaavtfgpsqvargedpalqicchpgctprpacchc
p

SCOP Domain Coordinates for d1auk__:

Click to download the PDB-style file with coordinates for d1auk__.
(The format of our PDB-style files is described here.)

Timeline for d1auk__: