![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.167: Peptide deformylase [56419] (1 superfamily) alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix |
![]() | Superfamily d.167.1: Peptide deformylase [56420] (2 families) ![]() nickel-dependent enzyme |
![]() | Family d.167.1.0: automated matches [191587] (1 protein) not a true family |
![]() | Protein automated matches [191055] (20 species) not a true protein |
![]() | Species Legionella pneumophila [TaxId:446] [350187] (1 PDB entry) |
![]() | Domain d6ck7d1: 6ck7 D:1-170 [350292] Other proteins in same PDB: d6ck7a2, d6ck7b2, d6ck7c2, d6ck7d2 automated match to d3qu1a_ complexed with bb2, so4, zn |
PDB Entry: 6ck7 (more details), 1.65 Å
SCOPe Domain Sequences for d6ck7d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ck7d1 d.167.1.0 (D:1-170) automated matches {Legionella pneumophila [TaxId: 446]} mairkilylpderlrkiakpvetfdeslqtlindmfdtmydargvglaapqigvslrlsv idivgdkkeqivivnpeivsshgekefeegclsvpgaydtvvraekvtvkaldrfgkpfe itgegllaeclqheidhmngklfvdmlsplkrmmarrkldkfkrlqarkp
Timeline for d6ck7d1: