![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) ![]() |
![]() | Family c.26.1.3: Adenylyltransferase [52397] (6 proteins) |
![]() | Protein Phosphopantetheine adenylyltransferase [52398] (7 species) |
![]() | Species Escherichia coli [TaxId:562] [52399] (10 PDB entries) |
![]() | Domain d6chpa_: 6chp A: [350291] Other proteins in same PDB: d6chpb2 automated match to d1gn8a_ complexed with f0y, pg4, so4 |
PDB Entry: 6chp (more details), 1.94 Å
SCOPe Domain Sequences for d6chpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6chpa_ c.26.1.3 (A:) Phosphopantetheine adenylyltransferase {Escherichia coli [TaxId: 562]} qkraiypgtfdpitnghidivtratqmfdhvilaiaaspskkpmftleervalaqqatah lgnvevvgfsdlmanfarnqhatvlirglravadfeyemqlahmnrhlmpelesvflmps kewsfissslvkevarhqgdvthflpenvhqalmakla
Timeline for d6chpa_: