Lineage for d6crta1 (6crt A:10-227)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2920699Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily)
    contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain
  4. 2920700Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families) (S)
  5. 2920701Family c.109.1.1: PEP carboxykinase N-terminal domain [68924] (3 proteins)
  6. 2920794Protein automated matches [257342] (3 species)
    not a true protein
  7. 2920795Species Escherichia coli [TaxId:562] [350276] (4 PDB entries)
  8. 2920799Domain d6crta1: 6crt A:10-227 [350277]
    Other proteins in same PDB: d6crta2
    automated match to d1os1a2
    complexed with atp, mn

Details for d6crta1

PDB Entry: 6crt (more details), 2 Å

PDB Description: arg65gln mutagenic e.coli pck
PDB Compounds: (A:) Phosphoenolpyruvate carboxykinase (ATP)

SCOPe Domain Sequences for d6crta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6crta1 c.109.1.1 (A:10-227) automated matches {Escherichia coli [TaxId: 562]}
qeleaygisdvhdivynpsydllyqeeldpsltgyergvltnlgavavdtgiftgqspkd
kyivrddttrdtfwwadkgkgkndnkplspetwqhlkglvtrqlsgkrlfvvdafcganp
dtrlsvrfitevawqahfvknmfirpsdeelagfkpdfivmngakctnpqwkeqglnsen
fvafnltermqliggtwyggemkkgmfsmmnyllplkg

SCOPe Domain Coordinates for d6crta1:

Click to download the PDB-style file with coordinates for d6crta1.
(The format of our PDB-style files is described here.)

Timeline for d6crta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6crta2