Lineage for d6eluc1 (6elu C:1-111)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2760546Domain d6eluc1: 6elu C:1-111 [350274]
    Other proteins in same PDB: d6elub_, d6eluc2, d6elue_, d6eluf2, d6eluh_, d6elui2, d6eluk_, d6elul2
    automated match to d2fd6l1

Details for d6eluc1

PDB Entry: 6elu (more details), 2.3 Å

PDB Description: structure of serum resistance associated protein from t. b. rhodesiense
PDB Compounds: (C:) G10_3 Light chain

SCOPe Domain Sequences for d6eluc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6eluc1 b.1.1.0 (C:1-111) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divmtqtppslavslgqratisckasqsvdydadsfmhwyqqkpgqppklliyaasnles
giparfsgsgsgtdftlnirpveeedaatyycqqsnedpwtfgggtkleik

SCOPe Domain Coordinates for d6eluc1:

Click to download the PDB-style file with coordinates for d6eluc1.
(The format of our PDB-style files is described here.)

Timeline for d6eluc1: