SCOPe 2.07: Domain d6cf5e1: 6cf5 E:11-324

Lineage for d6cf5e1 (6cf5 E:11-324)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.0: automated matches [227246] (1 protein)
   not a true family

6. Protein automated matches [227017] (57 species)
   not a true protein

7. Species Influenza a virus [TaxId:284218] [350160] (1 PDB entry)

8. Domain d6cf5e1: 6cf5 E:11-324 [350270]
   Other proteins in same PDB: d6cf5a2, d6cf5b1, d6cf5b2, d6cf5c2, d6cf5d1, d6cf5d2, d6cf5e2, d6cf5f1, d6cf5f2
   automated match to d3ztna_
   complexed with gol, nag, nhe, peg

Details for d6cf5e1

PDB Entry: 6cf5, 2.04 Å

PDB Description: crystal structure of the a/viet nam/1203/2004(h5n1) influenza virus hemagglutinin in complex with small molecule n-cyclohexyltaurine

PDB Compounds: (E:) Hemagglutinin

SCOPe Domain Sequences for d6cf5e1:

Sequence; same for both SEQRES and ATOM records:

>d6cf5e1 b.19.1.0 (E:11-324) automated matches {Influenza a virus [TaxId: 284218]}
dqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsvagw
llgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipks
swssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwgihh
pndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndain
fesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpltig
ecpkyvksnrlvlatglrnsp

Timeline for d6cf5e1:

• d6cf5e1 is new in SCOPe 2.07-stable
  
• d6cf5e1 appears in the current release, SCOPe 2.08