Lineage for d6cf5e1 (6cf5 E:11-324)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2776220Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2776221Protein automated matches [227017] (58 species)
    not a true protein
  7. 2776620Species Influenza a virus [TaxId:284218] [350160] (1 PDB entry)
  8. 2776623Domain d6cf5e1: 6cf5 E:11-324 [350270]
    Other proteins in same PDB: d6cf5a2, d6cf5b1, d6cf5b2, d6cf5c2, d6cf5d1, d6cf5d2, d6cf5e2, d6cf5f1, d6cf5f2
    automated match to d3ztna_
    complexed with gol, nag, nhe, peg

Details for d6cf5e1

PDB Entry: 6cf5 (more details), 2.04 Å

PDB Description: crystal structure of the a/viet nam/1203/2004(h5n1) influenza virus hemagglutinin in complex with small molecule n-cyclohexyltaurine
PDB Compounds: (E:) Hemagglutinin

SCOPe Domain Sequences for d6cf5e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cf5e1 b.19.1.0 (E:11-324) automated matches {Influenza a virus [TaxId: 284218]}
dqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsvagw
llgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipks
swssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwgihh
pndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndain
fesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpltig
ecpkyvksnrlvlatglrnsp

SCOPe Domain Coordinates for d6cf5e1:

Click to download the PDB-style file with coordinates for d6cf5e1.
(The format of our PDB-style files is described here.)

Timeline for d6cf5e1: