Lineage for d1elxb_ (1elx B:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 74262Fold c.76: Alkaline phosphatase-like [53648] (1 superfamily)
  4. 74263Superfamily c.76.1: Alkaline phosphatase-like [53649] (3 families) (S)
  5. 74264Family c.76.1.1: Alkaline phosphatase [53650] (1 protein)
  6. 74265Protein Alkaline phosphatase [53651] (2 species)
  7. 74266Species Escherichia coli [TaxId:562] [53652] (21 PDB entries)
  8. 74304Domain d1elxb_: 1elx B: [35027]

Details for d1elxb_

PDB Entry: 1elx (more details), 2.6 Å

PDB Description: e. coli alkaline phosphatase mutant (s102a)

SCOP Domain Sequences for d1elxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1elxb_ c.76.1.1 (B:) Alkaline phosphatase {Escherichia coli}
tpempvlenraaqgditapggarrltgdqtaalrdslsdkpakniilligdgmgdseita
arnyaegaggffkgidalpltgqythyalnkktgkpdyvtdaaasatawstgvktyngal
gvdihekdhptilemakaaglatgnvstaelqdatpaalvahvtsrkcygpsatsekcpg
nalekggkgsiteqllnaradvtlgggaktfaetatagewqgktlreqaqargyqlvsda
aslnsvteanqqkpllglfadgnmpvrwlgpkatyhgnidkpavtctpnpqrndsvptla
qmtdkaiellsknekgfflqvegasidkqdhaanpcgqigetvdldeavqralefakkeg
ntlvivtadhahasqivapdtkapgltqalntkdgavmvmsygnseedsqehtgsqlria
aygphaanvvgltdqtdlfytmkaalglk

SCOP Domain Coordinates for d1elxb_:

Click to download the PDB-style file with coordinates for d1elxb_.
(The format of our PDB-style files is described here.)

Timeline for d1elxb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1elxa_