Lineage for d6chqb_ (6chq B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2860045Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2860373Family c.26.1.3: Adenylyltransferase [52397] (6 proteins)
  6. 2860491Protein Phosphopantetheine adenylyltransferase [52398] (7 species)
  7. 2860494Species Escherichia coli [TaxId:562] [52399] (10 PDB entries)
  8. 2860504Domain d6chqb_: 6chq B: [350268]
    Other proteins in same PDB: d6chqa2
    automated match to d1gn8a_
    complexed with dms, f0v, pg4, so4

Details for d6chqb_

PDB Entry: 6chq (more details), 1.79 Å

PDB Description: phosphopantetheine adenylyltransferase (coad) in complex with 2- benzyl-n-(3-chloro-4-methylphenyl)-5-methyl-[1,2,4]triazolo[1,5- a]pyrimidin-7-amine
PDB Compounds: (B:) phosphopantetheine adenylyltransferase

SCOPe Domain Sequences for d6chqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6chqb_ c.26.1.3 (B:) Phosphopantetheine adenylyltransferase {Escherichia coli [TaxId: 562]}
qkraiypgtfdpitnghidivtratqmfdhvilaiaaspskkpmftleervalaqqatah
lgnvevvgfsdlmanfarnqhatvlirglravadfeyemqlahmnrhlmpelesvflmps
kewsfissslvkevarhqgdvthflpenvhqalmakla

SCOPe Domain Coordinates for d6chqb_:

Click to download the PDB-style file with coordinates for d6chqb_.
(The format of our PDB-style files is described here.)

Timeline for d6chqb_: