SCOPe 2.08: Domain d6al5l1: 6al5 L:1-110

Lineage for d6al5l1 (6al5 L:1-110)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d6al5l1: 6al5 L:1-110 [350263]
   Other proteins in same PDB: d6al5l2
   automated match to d1dn0a1
   complexed with nag; mutant

Details for d6al5l1

PDB Entry: 6al5, 3 Å

PDB Description: complex between cd19 (n138q mutant) and b43 fab

PDB Compounds: (L:) b43 light chain

SCOPe Domain Sequences for d6al5l1:

Sequence; same for both SEQRES and ATOM records:

>d6al5l1 b.1.1.0 (L:1-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqltqspsflsasvgdrvtitckasqsvdysgdsylnwyqqkpgkapklliydasnlvs
gvpsrfsgsgsgteftltisslqpedfatyycqqstenpwtfgggtklei

Timeline for d6al5l1:

• d6al5l1 first appeared in SCOPe 2.07